All sermorelin ghrp 6 results wholesalers & sermorelin ghrp 6 results manufacturers come from members. We doesn't provide sermorelin ghrp 6 results products or service, please contact them directly and verify their companies info carefully.
Total 2092 products from sermorelin ghrp 6 results Manufactures & Suppliers |
|
![]() |
Brand Name:Keray Model Number:86168-78-7 Place of Origin:China ... Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description: Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid |
Shenzhen Keray Biotech Co., Ltd
Guangdong |
![]() Brand Name:Saichuang Model Number:87616-84-0 Place of Origin:China ... 99% min Usage Peptides; Hormones and Regulation of Endocrine Function of D Appearance White powder Property GHRP-6, GHRP-2, GHRP2, GHRP6, ghrp HGH fragment177-191, HGH fragment 176-191AOD, EGF, MT-1, MT-2, |
Hongkong Saichuang Pharmaceutical Technology Co.,Ltd
Hubei |
![]() Brand Name:YIHAN Model Number:GHRP-2 Place of Origin:China ... Growth Hormone Peptide Pralmorelin benefits cycle dosage Quick Detail GHRP-2 (Pralmorelin) sterile lyophilized Peptide finished in 10mg/vial Description GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 CAS: 158861... |
Yihan Industrial Co.,Ltd.
Hongkong |
![]() |
Brand Name:SMQ Model Number:GHRP-2 Place of Origin:China mainland ... Growth Hormone Peptide Pralmorelin benefits cycle dosage Quick Detail GHRP-2 (Pralmorelin) sterile lyophilized Peptide finished in 10mg/vial Description GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 CAS: 158861... |
Shenzhen Haiwen Biotechnology Co.,Ltd
Guangdong |
![]() |
Brand Name:TINGYI Model Number:CAS: 86168-78-7 Place of Origin:CHINA ...98% High Purity Bio-identical Growth Hormone Peptide Sermorelin (2 mg/vial) Description: Sermorelin (INN) (trade name is Geref), also known as GHRH (1-29), is a growth hormone- releasing hormone (... |
Chongqing Tingyi Biotechnology Co.,Ltd
Chongqing |
![]() |
Brand Name:shinrezing Model Number:87616-84-0 Place of Origin:China ...Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS Number;87616-84-0 Ghrp-6 Molecular Formula;C46H56N12O6 Ghrp-6 Molecular Weight; 873.01 Ghrp-6 specification;5mg/vail or 10mg/vail *10vial/kit Ghrp-6 Assay;99.5% Ghrp-6 Appearance... |
Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Hubei |
![]() Brand Name:bodybiological Model Number:158861-67-7 Place of Origin:Hubei, China ...Research Chemical 99% Purity CAS158861-67-7 Peptides Ghrp 6 10mg/vial Basic Information for GHRP-6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar Mass: 873.014 ... |
Wuhan Body Biological Co.,Ltd
Hubei |
![]() Brand Name:Top Pharm Model Number:87616-84-0 Place of Origin:China ... for gaining muscles CAS number: 87616-84-0 2mg/vial white powder Product Name GHRP-6 Acetate Sequence Cas No. 87616-84-0 Molecular Formula C46H56N12O6 Molecular Weight 873.01 Purity (HPLC) ... |
TOP PHARM CO.,LIMITED
|
![]() Brand Name:FILTER Model Number:158861-67-7 Place of Origin:China ...Raw Material Peptide Powder CAS 158861-67-7 Ghrp-6 for Fat Loss Description Alias GHRP-2 Acetate; (DES-ALA3)-GROWTH E-RELEASING PEPTIDE-2 CAS 158861-67-7 M.F C45H55N9O6 M.W 818.0 Purity 99%min Appearance ... |
Passion Technology Development Limited
Henan |
![]() Brand Name:YC Model Number:GHRP-6 Place of Origin:China ...99.9% Purity GHRP6 Human Growth Hormmone Polypeptide GHRP -6 5mg / vial Description of Ghrp6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar Mass: 873.014 ... |
Hangzhou Fuluo Biological Technology Co.,Ltd.
Zhejiang |
![]() |
Brand Name:SGH Model Number:86168-78-7 Place of Origin:China ...- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino... |
Jiangsu Biostronger Technology Co.,Ltd
Jiangsu |
![]() Brand Name:YIHAN Model Number:Sermorelin 2mg Place of Origin:CHINA ...Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 Quick detail: Product Name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GROWTH HOR RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78... |
Yihan Industrial Co.,Ltd.
Guangdong |
![]() Brand Name:Holybiological Model Number:WhatsApp:+8613545014917 Place of Origin:China ...Nature Fat Loss and Anti Aging Polypeptide Hormones Ghrp-2 Growth Hormone Releasing Peptide Ghrp-2 Name GHRP-2 (Pralmorelin) (5mg/vial,10vials/kit) Other name GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 Appearance White powder... |
Hubei Holy Biological Co., Ltd.
Hubei |
![]() Brand Name:Pharma Grade Model Number:86168-78-7 Place of Origin:Zhejiang,China ...Sermorelin CAS86168-78-7 human growth Peptides for Muscle growth Polypeptides are compounds in which alpha-amino ... |
HONGKONG RONGXIN BIO-TECH CO.,LTD
Shaanxi |
![]() Brand Name:Peptides GHRP-2 Model Number:Peptides GHRP-2 Place of Origin:China ...Basic Info: Product name: GHRP-2 (GHRP-2 Acetate ) Synonym: Pralmorelin [INN]; D-Alanyl-3-(2-naphthalenyl)-D-alanyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide; GHRP 2; CAS: 158861-67-7 MF: C45H55N9O6 MW: 817.9749 Purity: 98% Appearance: White powder... |
Guangzhou Lishen Healthcare Co.,Ltd
Guangdong |
![]() Brand Name:BestSteroid Model Number:158861-67-7 Place of Origin:Hubei,China ... Releasing Peptide For Muscle Gain and Anti Aging GHRP-2 Basic Info GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate CAS: 158861-67-7 M.F.: C42H50N8O5 M.W.: 746.90 Purity (HPLC): 99.0%min. Appearance: White powder Single ... |
Hubei Yuancheng Saichuang Technology Co., Ltd.
Hubei |
![]() Brand Name:Hongxi Pharm Model Number:Sermorelin Place of Origin:HongKong ...High Purity Peptide Growth Hormone Sermorelin for Muscle Growth Bodybuilding CAS 86168-78-7 Lyophilized Powder Quick Details: Product Name: Sermorelin Alias: Somatoliberin,Sermorelin CAS: 86168-78-7 EINECS: - Assay: 99% MF: C149H246N44O42S MW: 3357... |
Hongxi International Pharmaceutical Co., Ltd.
Hongkong |
![]() Brand Name:TY-Chemical Model Number:87616-84-0 Place of Origin:China ... Top Pure Muscle Building Injection Our Safe through Customs Strengths: 1.Making sure GHRP-6 how is going to pass customs? GHRP-6 how to safely pass the customs problem, you don't have to worry... |
Guangzhou Teng yue Chemical Co., Ltd.
Guangdong |
![]() Brand Name:RAWSGEAR Model Number:86168-78-7 Place of Origin:China ...Weight loss Steroids Polypeptide Hormones Sermorelin Powder CAS 86168-78-7 Product name Sermorelin CAS No. 86168-78-7 MF C149H246N44O42S MW 3357.88 EINECS 1312995-182-4 storage temp −20°C Sermorelin is a GHRH (releasing hormone... |
Wuhan Shuiyixing Pharmaceutical Chemical Co., Ltd.
Hubei |
![]() Brand Name:KANGDISEN Model Number:2 mg/vial Place of Origin:China ... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was... |
Hongkong Kangdisen Medical Co., Limited
Hong Kong |